PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.1G447400.1.p
Common NamePRUPE_ppa007038mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 386aa    MW: 42736.6 Da    PI: 7.2726
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.1G447400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA551.1e-17267301135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  Prupe.1G447400.1.p 267 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 301
                         99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.121261297IPR000679Zinc finger, GATA-type
SMARTSM004014.7E-14261311IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.52E-14266325No hitNo description
CDDcd002023.63E-14266313No hitNo description
Gene3DG3DSA:3.30.50.108.4E-14266299IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.5E-15267301IPR000679Zinc finger, GATA-type
PROSITE patternPS003440267292IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MEAPKYFQNS FYPQFTPEKR HSFDNNNNKT TNGGGGGEDH FMVEDLLDFS NDDAVITDGG  60
ATFDNVTGNS IDSSTLTDID SCNSSSLSSS KPNVILDIGS KNIAEGPFSS DLCVPYEDLA  120
ELEWLSNFVE ESFYSENLQK LQLISGIKAQ PDETAFKTQQ FQPEPNRNDN AHNITTTNNN  180
LIFNLNVSVP AKARSKRSRA PPCNWTSRLL LLSQSTSSSE QFNVVSCVSA SPLLPQSTTG  240
KKMMKSAPKK KESPDGLGGG PGDCQKCLHC ATDKTPQWRT GPMGPKTLCN ACGVRYKSGR  300
LVPEYRPASS PTFVLTKHSN SHRKVLELRR QKEMVRTQQQ FIHQVLPQQH HHHHHHHHQN  360
MGCDVSNGGD YLIHPHAGLD FRQLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007223093.10.0hypothetical protein PRUPE_ppa007038mg
TrEMBLM5XDU80.0M5XDU8_PRUPE; Uncharacterized protein
STRINGVIT_04s0008g03270.t011e-141(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13643395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.13e-73GATA transcription factor 12